Lineage for d5d2mc_ (5d2m C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727312Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family) (S)
    automatically mapped to Pfam PF07834
  5. 2727313Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (2 proteins)
  6. 2727328Protein automated matches [191269] (1 species)
    not a true protein
  7. 2727329Species Human (Homo sapiens) [TaxId:9606] [189848] (4 PDB entries)
  8. 2727332Domain d5d2mc_: 5d2m C: [278938]
    Other proteins in same PDB: d5d2ma_, d5d2mb_, d5d2md_, d5d2me1, d5d2me2
    automated match to d2grrb_
    complexed with edo

Details for d5d2mc_

PDB Entry: 5d2m (more details), 2.4 Å

PDB Description: complex between human sumo2-rangap1, ubc9 and znf451
PDB Compounds: (C:) ran gtpase-activating protein 1

SCOPe Domain Sequences for d5d2mc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d2mc_ a.118.12.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppadvstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflkvssvfkdeatvrma
vqdavdalmqkafnsssfnsntfltrllvhmgllksedkvkaianlygplmalnhmvqqd
yfpkalaplllafvtkpnsalescsfarhsllqtlykv

SCOPe Domain Coordinates for d5d2mc_:

Click to download the PDB-style file with coordinates for d5d2mc_.
(The format of our PDB-style files is described here.)

Timeline for d5d2mc_: