SCOPe 2.05: Domain d5cseb_: 5cse B:

Lineage for d5cseb_ (5cse B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Streptomyces avidinii [TaxId:1895] [189343] (34 PDB entries)

8. Domain d5cseb_: 5cse B: [278928]
   automated match to d2bc3a_
   complexed with cl, svp

Details for d5cseb_

PDB Entry: 5cse, 1.79 Å

PDB Description: streptavidin-s112y-k121e complexed with palladium-containing biotin ligand

PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d5cseb_:

Sequence; same for both SEQRES and ATOM records:

>d5cseb_ b.61.1.1 (B:) automated matches {Streptomyces avidinii [TaxId: 1895]}
deagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltygtteanawestlvghdtftk
vk

Timeline for d5cseb_:

• d5cseb_ is new in SCOPe 2.05-stable
  
• d5cseb_ is called d5cseb1 in SCOPe 2.06
  
• d5cseb_ appears in the current release, SCOPe 2.08, called d5cseb1