Class b: All beta proteins [48724] (180 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) |
Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) |
Protein automated matches [190191] (2 species) not a true protein |
Species Streptomyces avidinii [TaxId:1895] [189343] (100 PDB entries) |
Domain d5cseb1: 5cse B:14-134 [278928] Other proteins in same PDB: d5csea2, d5cseb2 automated match to d2bc3a_ complexed with cl, svp |
PDB Entry: 5cse (more details), 1.79 Å
SCOPe Domain Sequences for d5cseb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cseb1 b.61.1.1 (B:14-134) automated matches {Streptomyces avidinii [TaxId: 1895]} eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal gwtvawknnyrnahsattwsgqyvggaearintqwlltygtteanawestlvghdtftkv k
Timeline for d5cseb1: