Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein automated matches [190099] (31 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [278910] (6 PDB entries) |
Domain d5csua_: 5csu A: [278927] automated match to d1x1na1 complexed with edo, hmc |
PDB Entry: 5csu (more details), 2.53 Å
SCOPe Domain Sequences for d5csua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5csua_ c.1.8.1 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} isvgedfpseyeqwlpvpdpesrrragvllhptsfrgphgigdlgeeafrfidwlhstgc svwqvlplvppdeggspyagqdancgntllisldelvkdgllikdelpqpidadsvnyqt anklksplitkaakrlidgngelksklldfrndpsiscwledaayfaaidntlnayswfe wpeplknrhlsaleaiyesqkefidlfiakqflfqrqwqkvreyarrqgvdimgdmpiyv gyhsadvwankkhfllnkkgfpllvsgvppdlfsetgqlwgsplydwkamesdqyswwvn rirraqdlydecridhfrgfagfwavpseakvamvgrwkvgpgkslfdaiskgvgkikii aedlgvitkdvvelrksigapgmavlqfafgggadnphlphnhevnqvvysgthdndtir gwwdtldqeekskamkylsiageddiswsviqaafsstaqtaiipmqdilglgssarmnt patevgnwgwripsstsfdnletesdrlrdllslygrl
Timeline for d5csua_: