SCOPe 2.06: Domain d5csea1: 5cse A:14-133

Lineage for d5csea1 (5cse A:14-133)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Streptomyces avidinii [TaxId:1895] [189343] (50 PDB entries)

8. Domain d5csea1: 5cse A:14-133 [278926]
   Other proteins in same PDB: d5csea2, d5cseb2
   automated match to d2bc3a_
   complexed with cl, svp

Details for d5csea1

PDB Entry: 5cse, 1.79 Å

PDB Description: streptavidin-s112y-k121e complexed with palladium-containing biotin ligand

PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d5csea1:

Sequence; same for both SEQRES and ATOM records:

>d5csea1 b.61.1.1 (A:14-133) automated matches {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaearintqwlltygtteanawestlvghdtftkv

Timeline for d5csea1:

• d5csea1 first appeared in SCOPe 2.05, called d5csea_
  
• d5csea1 appears in SCOPe 2.07
  
• d5csea1 appears in the current release, SCOPe 2.08