Lineage for d5csub_ (5csu B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2830345Protein automated matches [190099] (31 species)
    not a true protein
  7. 2830519Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [278910] (6 PDB entries)
  8. 2830531Domain d5csub_: 5csu B: [278923]
    automated match to d1x1na1
    complexed with edo, hmc

Details for d5csub_

PDB Entry: 5csu (more details), 2.53 Å

PDB Description: disproportionating enzyme 1 from arabidopsis - acarviostatin soak
PDB Compounds: (B:) 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic

SCOPe Domain Sequences for d5csub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5csub_ c.1.8.1 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
isvgedfpseyeqwlpvpdpesrrragvllhptsfrgphgigdlgeeafrfidwlhstgc
svwqvlplvppdeggspyagqdancgntllisldelvkdgllikdelpqpidadsvnyqt
anklksplitkaakrlidgngelksklldfrndpsiscwledaayfaaidntlnayswfe
wpeplknrhlsaleaiyesqkefidlfiakqflfqrqwqkvreyarrqgvdimgdmpiyv
gyhsadvwankkhfllnkkgfpllvsgvppdlfsetgqlwgsplydwkamesdqyswwvn
rirraqdlydecridhfrgfagfwavpseakvamvgrwkvgpgkslfdaiskgvgkikii
aedlgvitkdvvelrksigapgmavlqfafgggadnphlphnhevnqvvysgthdndtir
gwwdtldqeekskamkylsiageddiswsviqaafsstaqtaiipmqdilglgssarmnt
patevgnwgwripsstsfdnletesdrlrdllslygrl

SCOPe Domain Coordinates for d5csub_:

Click to download the PDB-style file with coordinates for d5csub_.
(The format of our PDB-style files is described here.)

Timeline for d5csub_: