Lineage for d1heb__ (1heb -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63199Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
  4. 63200Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) (S)
  5. 63201Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)
  6. 63202Protein Carbonic anhydrase [51071] (9 species)
  7. 63217Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (143 PDB entries)
  8. 63296Domain d1heb__: 1heb - [27892]

Details for d1heb__

PDB Entry: 1heb (more details), 2 Å

PDB Description: structural consequences of hydrophilic amino-acid substitutions in the hydrophobic pocket of human carbonic anhydrase ii

SCOP Domain Sequences for d1heb__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1heb__ b.74.1.1 (-) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II}
wgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnngh
afnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvhwn
tkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgll
pesldywtypgsettppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdnw
rpaqplknrqikasf

SCOP Domain Coordinates for d1heb__:

Click to download the PDB-style file with coordinates for d1heb__.
(The format of our PDB-style files is described here.)

Timeline for d1heb__: