SCOPe 2.07: Domain d5cpsa_: 5cps A:

Lineage for d5cpsa_ (5cps A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein automated matches [190099] (33 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [278910] (6 PDB entries)

8. Domain d5cpsa_: 5cps A: [278913]
   automated match to d1x1na1
   complexed with edo, glc

Details for d5cpsa_

PDB Entry: 5cps, 1.8 Å

PDB Description: disproportionating enzyme 1 from arabidopsis - maltotriose soak

PDB Compounds: (A:) 4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic

SCOPe Domain Sequences for d5cpsa_:

Sequence; same for both SEQRES and ATOM records:

>d5cpsa_ c.1.8.1 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
svgedfpseyeqwlpvpdpesrrragvllhptsfrgphgigdlgeeafrfidwlhstgcs
vwqvlplvppdeggspyagqdancgntllisldelvkdgllikdelpqpidadsvnyqta
nklksplitkaakrlidgngelksklldfrndpsiscwledaayfaaidntlnayswfew
peplknrhlsaleaiyesqkefidlfiakqflfqrqwqkvreyarrqgvdimgdmpiyvg
yhsadvwankkhfllnkkgfpllvsgvppdlfsetgqlwgsplydwkamesdqyswwvnr
irraqdlydecridhfrgfagfwavpseakvamvgrwkvgpgkslfdaiskgvgkikiia
edlgvitkdvvelrksigapgmavlqfafgggadnphlphnhevnqvvysgthdndtirg
wwdtldqeekskamkylsiageddiswsviqaafsstaqtaiipmqdilglgssarmntp
atevgnwgwripsstsfdnletesdrlrdllslygrl

Timeline for d5cpsa_:

• d5cpsa_ first appeared in SCOPe 2.05
  
• d5cpsa_ appears in SCOPe 2.06
  
• d5cpsa_ appears in the current release, SCOPe 2.08