Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein automated matches [190099] (33 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [278910] (6 PDB entries) |
Domain d5cpsa_: 5cps A: [278913] automated match to d1x1na1 complexed with edo, glc |
PDB Entry: 5cps (more details), 1.8 Å
SCOPe Domain Sequences for d5cpsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cpsa_ c.1.8.1 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} svgedfpseyeqwlpvpdpesrrragvllhptsfrgphgigdlgeeafrfidwlhstgcs vwqvlplvppdeggspyagqdancgntllisldelvkdgllikdelpqpidadsvnyqta nklksplitkaakrlidgngelksklldfrndpsiscwledaayfaaidntlnayswfew peplknrhlsaleaiyesqkefidlfiakqflfqrqwqkvreyarrqgvdimgdmpiyvg yhsadvwankkhfllnkkgfpllvsgvppdlfsetgqlwgsplydwkamesdqyswwvnr irraqdlydecridhfrgfagfwavpseakvamvgrwkvgpgkslfdaiskgvgkikiia edlgvitkdvvelrksigapgmavlqfafgggadnphlphnhevnqvvysgthdndtirg wwdtldqeekskamkylsiageddiswsviqaafsstaqtaiipmqdilglgssarmntp atevgnwgwripsstsfdnletesdrlrdllslygrl
Timeline for d5cpsa_: