Lineage for d1hea__ (1hea -)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.74: Carbonic anhydrase [51068] (1 superfamily) Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) 
Family b.74.1.1: Carbonic anhydrase [51070] (1 protein) Protein Carbonic anhydrase [51071] (9 species) Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (144 PDB entries) 
Domain d1hea__: 1hea - [27891]
Details for d1hea__
PDB Entry: 1hea (more details), 2 Å
PDB Description: carbonic anhydrase ii (carbonate dehydratase) (hca ii) (e.c.4.2.1.1) mutant with leu 198 replaced by arg (l198r)
SCOP Domain Sequences for d1hea__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hea__ b.74.1.1 (-) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II}
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
ntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgl
lpesldywtypgsrttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqikasf
SCOP Domain Coordinates for d1hea__:
Click to download the PDB-style file with coordinates for d1hea__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hea__:
- d1hea__ first appeared (with stable ids) in SCOP 1.55
- d1hea__ appears in SCOP 1.57
- d1hea__ appears in SCOP 1.61
- d1hea__ appears in the current release, SCOPe 2.08, called d1heaa_
View in 3D