Lineage for d5cmsp_ (5cms P:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881110Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 2881111Superfamily c.50.1: Macro domain-like [52949] (4 families) (S)
  5. 2881136Family c.50.1.2: Macro domain [89724] (7 proteins)
    found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme
  6. 2881179Protein automated matches [190472] (8 species)
    not a true protein
  7. 2881184Species Escherichia coli [TaxId:562] [278890] (1 PDB entry)
  8. 2881200Domain d5cmsp_: 5cms P: [278906]
    automated match to d1spva_
    complexed with apr, so4

Details for d5cmsp_

PDB Entry: 5cms (more details), 2.98 Å

PDB Description: structural insights into the mechanism of escherichia coli ymdb
PDB Compounds: (P:) O-acetyl-ADP-ribose deacetylase

SCOPe Domain Sequences for d5cmsp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cmsp_ c.50.1.2 (P:) automated matches {Escherichia coli [TaxId: 562]}
trihvvqgditklavdvivnaanpslmggggvdgaihraagpalldaclkvrqqqgdcpt
ghavitlagdlpakavvhtvgpvwrggeqnedqllqdaylnslrlvaansytsvafpais
tgvagypraaaaeiavktvsefitrhalpeqvyfvcydeenahlyerlltqq

SCOPe Domain Coordinates for d5cmsp_:

Click to download the PDB-style file with coordinates for d5cmsp_.
(The format of our PDB-style files is described here.)

Timeline for d5cmsp_: