| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (18 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries) |
| Domain d5cbeb_: 5cbe B: [278888] Other proteins in same PDB: d5cbea_, d5cbec_, d5cbee_, d5cbef_ automated match to d2rhea_ complexed with edo |
PDB Entry: 5cbe (more details), 2.4 Å
SCOPe Domain Sequences for d5cbeb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cbeb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
saltqpasvsaspgqsitisctgtssdvgaydwvswyqqhpgkapkllifdvnnrpsgvs
hrfsgsksgntasltisglqaedeadyycasatlldtyvfgtgtkvtvl
Timeline for d5cbeb_: