Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
Domain d5cbad1: 5cba D:1-106A [278887] Other proteins in same PDB: d5cbaa_, d5cbab2, d5cbac_, d5cbad2, d5cbae_, d5cbaf_ automated match to d2rhea_ complexed with edo, peg |
PDB Entry: 5cba (more details), 2.5 Å
SCOPe Domain Sequences for d5cbad1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cbad1 b.1.1.1 (D:1-106A) automated matches {Human (Homo sapiens) [TaxId: 9606]} qsaltqpasvsaspgqsitisctgtssdvgaydwvswyqqhpgkapkllifdvnnrpsgv shrfsgsksgntasltisglqaedeadyycssytrrdtyvfgtgtkvtvl
Timeline for d5cbad1: