![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (70 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187655] (109 PDB entries) |
![]() | Domain d5cblc_: 5cbl C: [278886] automated match to d3wlub_ complexed with bme, gol, so4 |
PDB Entry: 5cbl (more details), 1.78 Å
SCOPe Domain Sequences for d5cblc_:
Sequence, based on SEQRES records: (download)
>d5cblc_ b.29.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pptfnppvpyfgrlqggltarrtiiikgyvpptgksfainfkvgssgdialhinprmgng tvvrnsllngswgseekkithnpfgpgqffdlsircgldrfkvyangqhlfdfahrlsaf qrvdtleiqgdvtlsyvqi
>d5cblc_ b.29.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pptfnppvpyfgrlqggltarrtiiikgyvpptgksfainfkvsgdialhinprmgngtv vrnsllngswgseekkithnpfgpgqffdlsircgldrfkvyangqhlfdfahrlsaqrv dtleiqgdvtlsyvqi
Timeline for d5cblc_: