Lineage for d5cbab1 (5cba B:1-106A)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024002Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries)
  8. 2024285Domain d5cbab1: 5cba B:1-106A [278884]
    Other proteins in same PDB: d5cbaa_, d5cbab2, d5cbac_, d5cbad2, d5cbae_, d5cbaf_
    automated match to d2rhea_
    complexed with edo, peg

Details for d5cbab1

PDB Entry: 5cba (more details), 2.5 Å

PDB Description: 3b4 in complex with cxcl13 - 3b4-cxcl13
PDB Compounds: (B:) 3B4 light chain

SCOPe Domain Sequences for d5cbab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cbab1 b.1.1.1 (B:1-106A) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsaltqpasvsaspgqsitisctgtssdvgaydwvswyqqhpgkapkllifdvnnrpsgv
shrfsgsksgntasltisglqaedeadyycssytrrdtyvfgtgtkvtvl

SCOPe Domain Coordinates for d5cbab1:

Click to download the PDB-style file with coordinates for d5cbab1.
(The format of our PDB-style files is described here.)

Timeline for d5cbab1: