Lineage for d5cb4d2 (5cb4 D:244-431)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1914038Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1914315Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 1914316Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 1914423Protein automated matches [227071] (5 species)
    not a true protein
  7. 1914531Species Sus barbatus [TaxId:41807] [278826] (3 PDB entries)
  8. 1914535Domain d5cb4d2: 5cb4 D:244-431 [278880]
    Other proteins in same PDB: d5cb4a1, d5cb4b1, d5cb4c1, d5cb4d1, d5cb4e_
    automated match to d3rycd2
    complexed with acp, ca, gdp, gol, gtp, mes, mg, tiv

Details for d5cb4d2

PDB Entry: 5cb4 (more details), 2.19 Å

PDB Description: crystal structure of t2r-ttl-tivantinib complex
PDB Compounds: (D:) Tubulin beta

SCOPe Domain Sequences for d5cb4d2:

Sequence, based on SEQRES records: (download)

>d5cb4d2 d.79.2.1 (D:244-431) automated matches {Sus barbatus [TaxId: 41807]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

Sequence, based on observed residues (ATOM records): (download)

>d5cb4d2 d.79.2.1 (D:244-431) automated matches {Sus barbatus [TaxId: 41807]}
gqlnadlrklavnmvpfprlhffmpgfaplltvpeltqqmfdsknmmaacdprhgryltv
aaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfignsta
iqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqdatad

SCOPe Domain Coordinates for d5cb4d2:

Click to download the PDB-style file with coordinates for d5cb4d2.
(The format of our PDB-style files is described here.)

Timeline for d5cb4d2: