![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
![]() | Protein automated matches [227071] (7 species) not a true protein |
![]() | Species Sus barbatus [TaxId:41807] [278826] (7 PDB entries) |
![]() | Domain d5cb4d2: 5cb4 D:244-431 [278880] Other proteins in same PDB: d5cb4a1, d5cb4b1, d5cb4c1, d5cb4d1, d5cb4e_, d5cb4f1, d5cb4f2, d5cb4f3 automated match to d3rycd2 complexed with acp, ca, gdp, gol, gtp, mes, mg, tiv |
PDB Entry: 5cb4 (more details), 2.19 Å
SCOPe Domain Sequences for d5cb4d2:
Sequence, based on SEQRES records: (download)
>d5cb4d2 d.79.2.1 (D:244-431) automated matches {Sus barbatus [TaxId: 41807]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqdatad
>d5cb4d2 d.79.2.1 (D:244-431) automated matches {Sus barbatus [TaxId: 41807]} gqlnadlrklavnmvpfprlhffmpgfaplltvpeltqqmfdsknmmaacdprhgryltv aaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfignsta iqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqdatad
Timeline for d5cb4d2: