SCOPe 2.08: Domain d5cb4a1: 5cb4 A:1-245

Lineage for d5cb4a1 (5cb4 A:1-245)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein automated matches [226837] (9 species)
   not a true protein

7. Species Sus barbatus [TaxId:41807] [278811] (7 PDB entries)

8. Domain d5cb4a1: 5cb4 A:1-245 [278877]
   Other proteins in same PDB: d5cb4a2, d5cb4b2, d5cb4c2, d5cb4d2, d5cb4e_, d5cb4f1, d5cb4f2, d5cb4f3
   automated match to d4ihja1
   complexed with acp, ca, gdp, gol, gtp, mes, mg, tiv

Details for d5cb4a1

PDB Entry: 5cb4, 2.19 Å

PDB Description: crystal structure of t2r-ttl-tivantinib complex

PDB Compounds: (A:) Tubulin alpha

SCOPe Domain Sequences for d5cb4a1:

Sequence; same for both SEQRES and ATOM records:

>d5cb4a1 c.32.1.1 (A:1-245) automated matches {Sus barbatus [TaxId: 41807]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd

Timeline for d5cb4a1:

• d5cb4a1 first appeared in SCOPe 2.05
  
• d5cb4a1 appears in SCOPe 2.07