| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
| Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
| Protein automated matches [226837] (9 species) not a true protein |
| Species Sus barbatus [TaxId:41807] [278811] (7 PDB entries) |
| Domain d5cb4a1: 5cb4 A:1-245 [278877] Other proteins in same PDB: d5cb4a2, d5cb4b2, d5cb4c2, d5cb4d2, d5cb4e_, d5cb4f1, d5cb4f2, d5cb4f3 automated match to d4ihja1 complexed with acp, ca, gdp, gol, gtp, mes, mg, tiv |
PDB Entry: 5cb4 (more details), 2.19 Å
SCOPe Domain Sequences for d5cb4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cb4a1 c.32.1.1 (A:1-245) automated matches {Sus barbatus [TaxId: 41807]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita
slrfd
Timeline for d5cb4a1: