![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
![]() | Superfamily a.137.10: Stathmin [101494] (1 family) ![]() single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
![]() | Family a.137.10.1: Stathmin [101495] (1 protein) |
![]() | Protein Stathmin 4 [101496] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (32 PDB entries) |
![]() | Domain d5cb4e_: 5cb4 E: [278870] Other proteins in same PDB: d5cb4a1, d5cb4a2, d5cb4b1, d5cb4b2, d5cb4c1, d5cb4c2, d5cb4d1, d5cb4d2 automated match to d3ryce_ complexed with acp, ca, gdp, gol, gtp, mes, mg, tiv |
PDB Entry: 5cb4 (more details), 2.19 Å
SCOPe Domain Sequences for d5cb4e_:
Sequence, based on SEQRES records: (download)
>d5cb4e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe kdkhaeevrknkelke
>d5cb4e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk e
Timeline for d5cb4e_: