Lineage for d5cb4e_ (5cb4 E:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1750858Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 1751029Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 1751030Family a.137.10.1: Stathmin [101495] (1 protein)
  6. 1751031Protein Stathmin 4 [101496] (1 species)
  7. 1751032Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (32 PDB entries)
  8. 1751052Domain d5cb4e_: 5cb4 E: [278870]
    Other proteins in same PDB: d5cb4a1, d5cb4a2, d5cb4b1, d5cb4b2, d5cb4c1, d5cb4c2, d5cb4d1, d5cb4d2
    automated match to d3ryce_
    complexed with acp, ca, gdp, gol, gtp, mes, mg, tiv

Details for d5cb4e_

PDB Entry: 5cb4 (more details), 2.19 Å

PDB Description: crystal structure of t2r-ttl-tivantinib complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5cb4e_:

Sequence, based on SEQRES records: (download)

>d5cb4e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d5cb4e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e

SCOPe Domain Coordinates for d5cb4e_:

Click to download the PDB-style file with coordinates for d5cb4e_.
(The format of our PDB-style files is described here.)

Timeline for d5cb4e_: