Lineage for d1g4oa_ (1g4o A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 676371Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 676372Superfamily b.74.1: Carbonic anhydrase [51069] (1 family) (S)
  5. 676373Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)
  6. 676374Protein Carbonic anhydrase [51071] (10 species)
  7. 676402Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (197 PDB entries)
  8. 676510Domain d1g4oa_: 1g4o A: [27887]
    complexed with bsb, hg, zn; mutant

Details for d1g4oa_

PDB Entry: 1g4o (more details), 1.96 Å

PDB Description: carbonic anhydrase ii (f131v) complexed with 4-(aminosulfonyl)-n- phenylmethylbenzamide
PDB Compounds: (A:) carbonic anhydrase II

SCOP Domain Sequences for d1g4oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g4oa_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
wntkygdvgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

SCOP Domain Coordinates for d1g4oa_:

Click to download the PDB-style file with coordinates for d1g4oa_.
(The format of our PDB-style files is described here.)

Timeline for d1g4oa_: