SCOPe 2.06: Domain d5cbea_: 5cbe A:

Lineage for d5cbea_ (5cbe A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d5cbea_: 5cbe A: [278867]
   Other proteins in same PDB: d5cbeb_, d5cbed_, d5cbee_, d5cbef_
   automated match to d4odxh_
   complexed with edo

Details for d5cbea_

PDB Entry: 5cbe, 2.4 Å

PDB Description: e10 in complex with cxcl13

PDB Compounds: (A:) E10 heavy chain

SCOPe Domain Sequences for d5cbea_:

Sequence, based on SEQRES records:

>d5cbea_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipifgtany
aqkfqgrvtitadeststaymelsslrsedtavyycarepdyydssgyypidafdiwgqg
ttvtvss

Sequence, based on observed residues (ATOM records):

>d5cbea_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkkpgssvkvsckasgfssyaiswvrqapgqglewmggiipifgtanyaq
kfqgrvtitadeststaymelsslrsedtavyycarepdyydssgyypidafdiwgqgtt
vtvss

Timeline for d5cbea_:

• d5cbea_ first appeared in SCOPe 2.05
  
• d5cbea_ appears in SCOPe 2.07
  
• d5cbea_ appears in the current release, SCOPe 2.08