| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.50: Macro domain-like [52948] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest |
Superfamily c.50.1: Macro domain-like [52949] (4 families) ![]() |
| Family c.50.1.2: Macro domain [89724] (7 proteins) found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme |
| Protein automated matches [190472] (8 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [278845] (2 PDB entries) |
| Domain d5cb5f_: 5cb5 F: [278856] automated match to d1spva_ complexed with act, apr, so4, zod |
PDB Entry: 5cb5 (more details), 2.8 Å
SCOPe Domain Sequences for d5cb5f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cb5f_ c.50.1.2 (F:) automated matches {Escherichia coli [TaxId: 83333]}
ktrihvvqgditklavdvivnaaapslmggggvagaihraagpalldaclkvrqqqgdcp
tghavitlagdlpakavvhtvgpvwrggeqnedqllqdaylnslrlvaansytsvafpai
stgvygypraaaaeiavktvsefitrhalpeqvyfvcydeenahlyerlltqq
Timeline for d5cb5f_: