| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d5cbac_: 5cba C: [278854] Other proteins in same PDB: d5cbab1, d5cbab2, d5cbad1, d5cbad2, d5cbae_, d5cbaf_ automated match to d4odxh_ complexed with edo, peg |
PDB Entry: 5cba (more details), 2.5 Å
SCOPe Domain Sequences for d5cbac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cbac_ b.1.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipifgtany
aqkfqgrvtitadeststaymelsslrsedtavyycarepdyydssgyypidafdiwgqg
ttvtvss
Timeline for d5cbac_: