SCOPe 2.05: Domain d5c6wh2: 5c6w H:1001-1110

Lineage for d5c6wh2 (5c6w H:1001-1110)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)

8. Domain d5c6wh2: 5c6w H:1001-1110 [278852]
   automated match to d4p48a1
   complexed with cl, edo, peg, so4

Details for d5c6wh2

PDB Entry: 5c6w, 1.54 Å

PDB Description: anti-cxcl13 scfv - e10

PDB Compounds: (H:) Protein IGHV1-69-2,Ig lambda chain V-II region NIG-84

SCOPe Domain Sequences for d5c6wh2:

Sequence; same for both SEQRES and ATOM records:

>d5c6wh2 b.1.1.0 (H:1001-1110) automated matches {Homo sapiens [TaxId: 9606]}
qsaltqpasvsaspgqsitisctgtssdvgaydwvswyqqhpgkapkllifdvnnrpsgv
shrfsgsksgntasltisglqaedeadyycasatlldtyvfgtgtkvtvl

Timeline for d5c6wh2:

• d5c6wh2 is new in SCOPe 2.05-stable
  
• d5c6wh2 appears in SCOPe 2.06
  
• d5c6wh2 appears in the current release, SCOPe 2.08