Lineage for d5cbaa_ (5cba A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758067Domain d5cbaa_: 5cba A: [278850]
    Other proteins in same PDB: d5cbab1, d5cbab2, d5cbad1, d5cbad2, d5cbae_, d5cbaf_
    automated match to d4odxh_
    complexed with edo, peg

Details for d5cbaa_

PDB Entry: 5cba (more details), 2.5 Å

PDB Description: 3b4 in complex with cxcl13 - 3b4-cxcl13
PDB Compounds: (A:) 3b4 heavy chain

SCOPe Domain Sequences for d5cbaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cbaa_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipifgtany
aqkfqgrvtitadeststaymelsslrsedtavyycarepdyydssgyypidafdiwgqg
ttvtvss

SCOPe Domain Coordinates for d5cbaa_:

Click to download the PDB-style file with coordinates for d5cbaa_.
(The format of our PDB-style files is described here.)

Timeline for d5cbaa_: