Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) form dimers with different dimerisation modes |
Family d.9.1.0: automated matches [191483] (1 protein) not a true family |
Protein automated matches [190775] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188003] (12 PDB entries) |
Domain d5cbaf_: 5cba F: [278843] Other proteins in same PDB: d5cbaa_, d5cbab1, d5cbab2, d5cbac_, d5cbad1, d5cbad2 automated match to d1ikma_ complexed with edo, peg |
PDB Entry: 5cba (more details), 2.5 Å
SCOPe Domain Sequences for d5cbaf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cbaf_ d.9.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} slrcrcvqessvfiprrfidriqilprgngcprkeiivwkknksivcvdpqaewiqrmme vlrk
Timeline for d5cbaf_: