| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) ![]() form dimers with different dimerisation modes |
| Family d.9.1.0: automated matches [191483] (1 protein) not a true family |
| Protein automated matches [190775] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188003] (12 PDB entries) |
| Domain d5cbef_: 5cbe F: [278841] Other proteins in same PDB: d5cbea_, d5cbeb_, d5cbec_, d5cbed_ automated match to d1ikma_ complexed with edo |
PDB Entry: 5cbe (more details), 2.4 Å
SCOPe Domain Sequences for d5cbef_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cbef_ d.9.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tslrcrcvqessvfiprrfidriqilprgngcprkeiivwkknksivcvdpqaewiqrmm
evlrkr
Timeline for d5cbef_: