Lineage for d5cbef_ (5cbe F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928974Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2928975Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2929386Family d.9.1.0: automated matches [191483] (1 protein)
    not a true family
  6. 2929387Protein automated matches [190775] (3 species)
    not a true protein
  7. 2929388Species Human (Homo sapiens) [TaxId:9606] [188003] (12 PDB entries)
  8. 2929418Domain d5cbef_: 5cbe F: [278841]
    Other proteins in same PDB: d5cbea_, d5cbeb_, d5cbec_, d5cbed_
    automated match to d1ikma_
    complexed with edo

Details for d5cbef_

PDB Entry: 5cbe (more details), 2.4 Å

PDB Description: e10 in complex with cxcl13
PDB Compounds: (F:) C-X-C motif chemokine 13

SCOPe Domain Sequences for d5cbef_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cbef_ d.9.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tslrcrcvqessvfiprrfidriqilprgngcprkeiivwkknksivcvdpqaewiqrmm
evlrkr

SCOPe Domain Coordinates for d5cbef_:

Click to download the PDB-style file with coordinates for d5cbef_.
(The format of our PDB-style files is described here.)

Timeline for d5cbef_: