SCOP 1.69: Domain d1hec__: 1hec -

Lineage for d1hec__ (1hec -)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (1 family)

5. Family b.74.1.1: Carbonic anhydrase [51070] (1 protein)

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (153 PDB entries)

8. Domain d1hec__: 1hec - [27884]

Details for d1hec__

PDB Entry: 1hec, 2 Å

PDB Description: structural consequences of hydrophilic amino-acid substitutions in the hydrophobic pocket of human carbonic anhydrase ii

SCOP Domain Sequences for d1hec__:

Sequence; same for both SEQRES and ATOM records:

>d1hec__ b.74.1.1 (-) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II}
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
ntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgl
lpesldywtypgshttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqikasf

Timeline for d1hec__:

• d1hec__ first appeared (with stable ids) in SCOP 1.55
  
• d1hec__ appears in SCOP 1.67
  
• d1hec__ appears in SCOP 1.71
  
• d1hec__ appears in the current release, SCOPe 2.08, called d1heca_