Lineage for d5ca1c2 (5ca1 C:246-440)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2201404Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2201405Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2201524Protein automated matches [227071] (5 species)
    not a true protein
  7. 2201777Species Sus barbatus [TaxId:41807] [278826] (7 PDB entries)
  8. 2201783Domain d5ca1c2: 5ca1 C:246-440 [278837]
    Other proteins in same PDB: d5ca1a1, d5ca1b1, d5ca1c1, d5ca1d1, d5ca1e_
    automated match to d4i50a2
    complexed with acp, ca, gdp, gol, gtp, mes, mg, nzo

Details for d5ca1c2

PDB Entry: 5ca1 (more details), 2.4 Å

PDB Description: crystal structure of t2r-ttl-nocodazole complex
PDB Compounds: (C:) Tubulin alpha

SCOPe Domain Sequences for d5ca1c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ca1c2 d.79.2.1 (C:246-440) automated matches {Sus barbatus [TaxId: 41807]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

SCOPe Domain Coordinates for d5ca1c2:

Click to download the PDB-style file with coordinates for d5ca1c2.
(The format of our PDB-style files is described here.)

Timeline for d5ca1c2: