![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
![]() | Protein automated matches [227071] (5 species) not a true protein |
![]() | Species Sus barbatus [TaxId:41807] [278826] (7 PDB entries) |
![]() | Domain d5c8ya2: 5c8y A:246-437 [278835] Other proteins in same PDB: d5c8ya1, d5c8yb1, d5c8yc1, d5c8yd1, d5c8ye_, d5c8yf1, d5c8yf2, d5c8yf3 automated match to d4i50a2 complexed with acp, ca, gdp, gtp, mes, mg, pn6 |
PDB Entry: 5c8y (more details), 2.59 Å
SCOPe Domain Sequences for d5c8ya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c8ya2 d.79.2.1 (A:246-437) automated matches {Sus barbatus [TaxId: 41807]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgv
Timeline for d5c8ya2: