Lineage for d5c8yc2 (5c8y C:246-440)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959213Protein automated matches [227071] (7 species)
    not a true protein
  7. 2960015Species Sus barbatus [TaxId:41807] [278826] (7 PDB entries)
  8. 2960024Domain d5c8yc2: 5c8y C:246-440 [278831]
    Other proteins in same PDB: d5c8ya1, d5c8yb1, d5c8yc1, d5c8yd1, d5c8ye_, d5c8yf1, d5c8yf2, d5c8yf3
    automated match to d4i50a2
    complexed with acp, ca, gdp, gtp, mes, mg, pn6

Details for d5c8yc2

PDB Entry: 5c8y (more details), 2.59 Å

PDB Description: crystal structure of t2r-ttl-plinabulin complex
PDB Compounds: (C:) Tubulin alpha

SCOPe Domain Sequences for d5c8yc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c8yc2 d.79.2.1 (C:246-440) automated matches {Sus barbatus [TaxId: 41807]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvdsv

SCOPe Domain Coordinates for d5c8yc2:

Click to download the PDB-style file with coordinates for d5c8yc2.
(The format of our PDB-style files is described here.)

Timeline for d5c8yc2: