SCOPe 2.08: Domain d5c8yb2: 5c8y B:244-428

Lineage for d5c8yb2 (5c8y B:244-428)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Sus barbatus [TaxId:41807] [278826] (7 PDB entries)

8. Domain d5c8yb2: 5c8y B:244-428 [278829]
   Other proteins in same PDB: d5c8ya1, d5c8yb1, d5c8yc1, d5c8yd1, d5c8ye_, d5c8yf1, d5c8yf2, d5c8yf3
   automated match to d3rycd2
   complexed with acp, ca, gdp, gtp, mes, mg, pn6

Details for d5c8yb2

PDB Entry: 5c8y, 2.59 Å

PDB Description: crystal structure of t2r-ttl-plinabulin complex

PDB Compounds: (B:) Tubulin beta

SCOPe Domain Sequences for d5c8yb2:

Sequence; same for both SEQRES and ATOM records:

>d5c8yb2 d.79.2.1 (B:244-428) automated matches {Sus barbatus [TaxId: 41807]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqda

Timeline for d5c8yb2:

• d5c8yb2 first appeared in SCOPe 2.05
  
• d5c8yb2 appears in SCOPe 2.07