| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
| Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
| Protein automated matches [226837] (9 species) not a true protein |
| Species Sus barbatus [TaxId:41807] [278811] (7 PDB entries) |
| Domain d5c8yb1: 5c8y B:2-243 [278828] Other proteins in same PDB: d5c8ya2, d5c8yb2, d5c8yc2, d5c8yd2, d5c8ye_, d5c8yf1, d5c8yf2, d5c8yf3 automated match to d4drxb1 complexed with acp, ca, gdp, gtp, mes, mg, pn6 |
PDB Entry: 5c8y (more details), 2.59 Å
SCOPe Domain Sequences for d5c8yb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c8yb1 c.32.1.1 (B:2-243) automated matches {Sus barbatus [TaxId: 41807]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp
Timeline for d5c8yb1: