![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
![]() | Protein automated matches [227071] (7 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [278823] (2 PDB entries) |
![]() | Domain d5ca1b2: 5ca1 B:244-428 [278824] Other proteins in same PDB: d5ca1a1, d5ca1b1, d5ca1c1, d5ca1d1, d5ca1e_, d5ca1f1, d5ca1f2, d5ca1f3 automated match to d3rycd2 complexed with acp, ca, gdp, gol, gtp, mes, mg, nzo |
PDB Entry: 5ca1 (more details), 2.4 Å
SCOPe Domain Sequences for d5ca1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ca1b2 d.79.2.1 (B:244-428) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq qyqda
Timeline for d5ca1b2: