![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) ![]() automatically mapped to Pfam PF00091 |
![]() | Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
![]() | Protein automated matches [226837] (10 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [278810] (20 PDB entries) |
![]() | Domain d5ca1b1: 5ca1 B:2-243 [278822] Other proteins in same PDB: d5ca1a2, d5ca1b2, d5ca1c2, d5ca1d2, d5ca1e_, d5ca1f1, d5ca1f2, d5ca1f3 automated match to d4drxb1 complexed with acp, ca, gdp, gol, gtp, mes, mg, nzo |
PDB Entry: 5ca1 (more details), 2.4 Å
SCOPe Domain Sequences for d5ca1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ca1b1 c.32.1.1 (B:2-243) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr fp
Timeline for d5ca1b1: