![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
![]() | Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
![]() | Protein automated matches [227071] (7 species) not a true protein |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [278816] (54 PDB entries) |
![]() | Domain d5ca0a2: 5ca0 A:246-437 [278819] Other proteins in same PDB: d5ca0a1, d5ca0b1, d5ca0c1, d5ca0d1, d5ca0e_, d5ca0f1, d5ca0f2, d5ca0f3 automated match to d4i50a2 complexed with acp, ca, gdp, gol, gtp, lxl, mes, mg |
PDB Entry: 5ca0 (more details), 2.5 Å
SCOPe Domain Sequences for d5ca0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ca0a2 d.79.2.1 (A:246-437) automated matches {Pig (Sus scrofa) [TaxId: 9823]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgv
Timeline for d5ca0a2: