SCOPe 2.08: Domain d5ca0a2: 5ca0 A:246-437

Lineage for d5ca0a2 (5ca0 A:246-437)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein automated matches [227071] (7 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries)

8. Domain d5ca0a2: 5ca0 A:246-437 [278819]
   Other proteins in same PDB: d5ca0a1, d5ca0b1, d5ca0c1, d5ca0d1, d5ca0e_, d5ca0f1, d5ca0f2, d5ca0f3
   automated match to d4i50a2
   complexed with acp, ca, gdp, gol, gtp, lxl, mes, mg

Details for d5ca0a2

PDB Entry: 5ca0, 2.5 Å

PDB Description: crystal structure of t2r-ttl-lexibulin complex

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5ca0a2:

Sequence; same for both SEQRES and ATOM records:

>d5ca0a2 d.79.2.1 (A:246-437) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgv

Timeline for d5ca0a2:

• d5ca0a2 first appeared in SCOPe 2.05
  
• d5ca0a2 appears in SCOPe 2.07