Lineage for d5ca0a2 (5ca0 A:246-437)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959213Protein automated matches [227071] (7 species)
    not a true protein
  7. 2959756Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries)
  8. 2959864Domain d5ca0a2: 5ca0 A:246-437 [278819]
    Other proteins in same PDB: d5ca0a1, d5ca0b1, d5ca0c1, d5ca0d1, d5ca0e_, d5ca0f1, d5ca0f2, d5ca0f3
    automated match to d4i50a2
    complexed with acp, ca, gdp, gol, gtp, lxl, mes, mg

Details for d5ca0a2

PDB Entry: 5ca0 (more details), 2.5 Å

PDB Description: crystal structure of t2r-ttl-lexibulin complex
PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d5ca0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ca0a2 d.79.2.1 (A:246-437) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgv

SCOPe Domain Coordinates for d5ca0a2:

Click to download the PDB-style file with coordinates for d5ca0a2.
(The format of our PDB-style files is described here.)

Timeline for d5ca0a2: