Lineage for d5ca0d2 (5ca0 D:244-431)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2201404Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2201405Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2201524Protein automated matches [227071] (5 species)
    not a true protein
  7. 2201706Species Pig (Sus scrofa) [TaxId:9823] [278816] (9 PDB entries)
  8. 2201721Domain d5ca0d2: 5ca0 D:244-431 [278818]
    Other proteins in same PDB: d5ca0a1, d5ca0b1, d5ca0c1, d5ca0d1, d5ca0e_
    automated match to d3rycd2
    complexed with acp, ca, gdp, gol, gtp, lxl, mes, mg

Details for d5ca0d2

PDB Entry: 5ca0 (more details), 2.5 Å

PDB Description: crystal structure of t2r-ttl-lexibulin complex
PDB Compounds: (D:) Uncharacterized protein

SCOPe Domain Sequences for d5ca0d2:

Sequence, based on SEQRES records: (download)

>d5ca0d2 d.79.2.1 (D:244-431) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

Sequence, based on observed residues (ATOM records): (download)

>d5ca0d2 d.79.2.1 (D:244-431) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfaplltvpeltqqmfdsknmmaacdprhgryltv
aaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfignsta
iqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqdatad

SCOPe Domain Coordinates for d5ca0d2:

Click to download the PDB-style file with coordinates for d5ca0d2.
(The format of our PDB-style files is described here.)

Timeline for d5ca0d2: