![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.137.10: Stathmin [101494] (1 family) ![]() single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
![]() | Family a.137.10.1: Stathmin [101495] (2 proteins) |
![]() | Protein Stathmin 4 [101496] (3 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries) |
![]() | Domain d5ca0e_: 5ca0 E: [278809] Other proteins in same PDB: d5ca0a1, d5ca0a2, d5ca0b1, d5ca0b2, d5ca0c1, d5ca0c2, d5ca0d1, d5ca0d2, d5ca0f1, d5ca0f2, d5ca0f3 automated match to d3ryce_ complexed with acp, ca, gdp, gol, gtp, lxl, mes, mg |
PDB Entry: 5ca0 (more details), 2.5 Å
SCOPe Domain Sequences for d5ca0e_:
Sequence, based on SEQRES records: (download)
>d5ca0e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe kdkhaeevrknkelke
>d5ca0e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk e
Timeline for d5ca0e_: