Lineage for d5c8ye_ (5c8y E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2733915Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 2733916Family a.137.10.1: Stathmin [101495] (2 proteins)
  6. 2733917Protein Stathmin 4 [101496] (3 species)
  7. 2733934Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (186 PDB entries)
  8. 2734086Domain d5c8ye_: 5c8y E: [278805]
    Other proteins in same PDB: d5c8ya1, d5c8ya2, d5c8yb1, d5c8yb2, d5c8yc1, d5c8yc2, d5c8yd1, d5c8yd2, d5c8yf1, d5c8yf2, d5c8yf3
    automated match to d3ryce_
    complexed with acp, ca, gdp, gtp, mes, mg, pn6

Details for d5c8ye_

PDB Entry: 5c8y (more details), 2.59 Å

PDB Description: crystal structure of t2r-ttl-plinabulin complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d5c8ye_:

Sequence, based on SEQRES records: (download)

>d5c8ye_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelke

Sequence, based on observed residues (ATOM records): (download)

>d5c8ye_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
e

SCOPe Domain Coordinates for d5c8ye_:

Click to download the PDB-style file with coordinates for d5c8ye_.
(The format of our PDB-style files is described here.)

Timeline for d5c8ye_: