Lineage for d5c2bh_ (5c2b H:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2355447Domain d5c2bh_: 5c2b H: [278804]
    Other proteins in same PDB: d5c2bl_
    automated match to d4odxh_
    complexed with cl

Details for d5c2bh_

PDB Entry: 5c2b (more details), 1.4 Å

PDB Description: anti-cxcl13 parental scfv - 3b4
PDB Compounds: (H:) scFv 3B4 heavy chain

SCOPe Domain Sequences for d5c2bh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c2bh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipifgtany
aqkfqgrvtitadeststaymelsslrsedtavyycarepdyydssgyypidafdiwgqg
ttvtvssggg

SCOPe Domain Coordinates for d5c2bh_:

Click to download the PDB-style file with coordinates for d5c2bh_.
(The format of our PDB-style files is described here.)

Timeline for d5c2bh_: