SCOPe 2.05: Domain d5c3ta_: 5c3t A:

Lineage for d5c3ta_ (5c3t A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [268548] (95 PDB entries)

8. Domain d5c3ta_: 5c3t A: [278803]
   automated match to d4jkwa_

Details for d5c3ta_

PDB Entry: 5c3t, 1.8 Å

PDB Description: pd-1 binding domain from human pd-l1

PDB Compounds: (A:) Programmed cell death 1 ligand 1

SCOPe Domain Sequences for d5c3ta_:

Sequence; same for both SEQRES and ATOM records:

>d5c3ta_ b.1.1.0 (A:) automated matches {Homo sapiens [TaxId: 9606]}
aftvtvpkdlyvveygsnmtieckfpvekeldlaalivywemedkniiqfvhgeedlkvq
hssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnapyaaa
lehhhh

Timeline for d5c3ta_:

• d5c3ta_ is new in SCOPe 2.05-stable
  
• d5c3ta_ is called d5c3ta1 in SCOPe 2.06
  
• d5c3ta_ appears in the current release, SCOPe 2.08, called d5c3ta1