Lineage for d5ah0a1 (5ah0 A:17-400)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2902646Species Pelosinus fermentans [TaxId:1122947] [278791] (1 PDB entry)
  8. 2902647Domain d5ah0a1: 5ah0 A:17-400 [278802]
    Other proteins in same PDB: d5ah0a2, d5ah0b2
    automated match to d1ku0b_
    complexed with k, peg, zn

Details for d5ah0a1

PDB Entry: 5ah0 (more details), 2.5 Å

PDB Description: structure of lipase 1 from pelosinus fermentans
PDB Compounds: (A:) Lipase

SCOPe Domain Sequences for d5ah0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ah0a1 c.69.1.0 (A:17-400) automated matches {Pelosinus fermentans [TaxId: 1122947]}
nsypivlvhgfmgwgrnevlglkywggitdyeqelssygytaytatvgpvssnwdracel
yayikggtvdyghahstqkghsrygrtypglypewgnlttegkvnkihlvahsmggqtvr
tlvqllkegseeernttpsqlsslfaggkswvhsittiasphdgttladginifgdfakn
lvaslasftgagekliydfkldqwglnrksgesltdytnrvfnsaiwnstndlanwdlst
dgarvlnqwvkaqsdiyyfsystcatvpsiltsnelphviymtpllypfgrfigsytrne
qgrviidnswkpndgvvntisqngpkiwssdkivnyngvpqigkwnsmplldtidhmdac
gigtnaltlswykglaeklsqlti

SCOPe Domain Coordinates for d5ah0a1:

Click to download the PDB-style file with coordinates for d5ah0a1.
(The format of our PDB-style files is described here.)

Timeline for d5ah0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ah0a2