Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (124 species) not a true protein |
Species Pelosinus fermentans [TaxId:1122947] [278791] (1 PDB entry) |
Domain d5ah0b1: 5ah0 B:17-402 [278801] Other proteins in same PDB: d5ah0a2, d5ah0b2 automated match to d1ku0b_ complexed with k, peg, zn |
PDB Entry: 5ah0 (more details), 2.5 Å
SCOPe Domain Sequences for d5ah0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ah0b1 c.69.1.0 (B:17-402) automated matches {Pelosinus fermentans [TaxId: 1122947]} nsypivlvhgfmgwgrnevlglkywggitdyeqelssygytaytatvgpvssnwdracel yayikggtvdyghahstqkghsrygrtypglypewgnlttegkvnkihlvahsmggqtvr tlvqllkegseeernttpsqlsslfaggkswvhsittiasphdgttladginifgdfakn lvaslasftgagekliydfkldqwglnrksgesltdytnrvfnsaiwnstndlanwdlst dgarvlnqwvkaqsdiyyfsystcatvpsiltsnelphviymtpllypfgrfigsytrne qgrviidnswkpndgvvntisqngpkiwssdkivnyngvpqigkwnsmplldtidhmdac gigtnaltlswykglaeklsqltisn
Timeline for d5ah0b1: