Lineage for d1cnha_ (1cnh A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. Protein Carbonic anhydrase [51071] (10 species)
  7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (966 PDB entries)
    Uniprot P00918
  8. Domain d1cnha_: 1cnh A: [27880]
    complexed with zn

Details for d1cnha_

PDB Entry: 1cnh (more details), 2.05 Å

PDB Description: x-ray crystallographic studies of engineered hydrogen bond networks in a protein-zinc binding site
PDB Compounds: (A:) carbonic anhydrase II

SCOPe Domain Sequences for d1cnha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cnha_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hafnvefddsqdkavlkggpldgtyrliefhfhwgsldgqgsehtvdkkkyaaelhlvhw
ntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgl
lpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqikasfk

SCOPe Domain Coordinates for d1cnha_ are not available.

Timeline for d1cnha_: