SCOPe 2.07: Domain d5acwb_: 5acw B:

Lineage for d5acwb_ (5acw B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein automated matches [190079] (12 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [189349] (72 PDB entries)

8. Domain d5acwb_: 5acw B: [278796]
   automated match to d4ua4b_
   complexed with cl, oh, rhu, zn

Details for d5acwb_

PDB Entry: 5acw, 1.8 Å

PDB Description: vim-2-1, discovery of novel inhibitor scaffolds against the metallo- beta-lactamase vim-2 by spr based fragment screening

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d5acwb_:

Sequence; same for both SEQRES and ATOM records:

>d5acwb_ d.157.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
geyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgak
ntaallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegnei
pthsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagn
vadadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnrs

Timeline for d5acwb_:

• d5acwb_ first appeared in SCOPe 2.05
  
• d5acwb_ appears in SCOPe 2.06
  
• d5acwb_ appears in the current release, SCOPe 2.08