Lineage for d5abqa_ (5abq A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719957Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2719958Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2720706Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2720707Protein automated matches [191104] (14 species)
    not a true protein
  7. 2720844Species Pleurotus eryngii [TaxId:5323] [226503] (19 PDB entries)
  8. 2720863Domain d5abqa_: 5abq A: [278790]
    automated match to d3fm4a_
    complexed with ca, hem; mutant

Details for d5abqa_

PDB Entry: 5abq (more details), 2.29 Å

PDB Description: crystal structure analysis of fungal versatile peroxidase from pleurotus eryngii. mutant vpi-ss. mutated residues t2k, a49c, a61c, d69s, t70d, s86e, a131k, d146t, q202l, q219k, h232e, q239r, l288r, s301k, a308r,a309k and a314r.
PDB Compounds: (A:) versatile peroxidase

SCOPe Domain Sequences for d5abqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5abqa_ a.93.1.0 (A:) automated matches {Pleurotus eryngii [TaxId: 5323]}
cddgrttanaaccilfpilddiqenlfdgaqcgeevheslrltfhdcigfsptlggggcd
gsiiafsdietnfpanagideiveaqkpfvakhnisagdfiqfagavgvsncpggvripf
flgrpdavkaspdhlvpepfdsvtsilarmgdagfspvevvwllashsiaaadkvdpsip
gtpfdstpgvfdsqffietllkgrlfpgtadnkgeaqsplqgeirlqsdellardprtac
ewqsmvnnqpkiqnrfaatmskmallgqdktklidcsdviptppalvgaahlpagfslkd
veqacrktpfpr

SCOPe Domain Coordinates for d5abqa_:

Click to download the PDB-style file with coordinates for d5abqa_.
(The format of our PDB-style files is described here.)

Timeline for d5abqa_: