SCOPe 2.08: Domain d5aboa1: 5abo A:3-315

Lineage for d5aboa1 (5abo A:3-315)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.0: automated matches [191605] (1 protein)
   not a true family

6. Protein automated matches [191104] (14 species)
   not a true protein

7. Species Pleurotus eryngii [TaxId:5323] [226503] (19 PDB entries)

8. Domain d5aboa1: 5abo A:3-315 [278789]
   Other proteins in same PDB: d5aboa2
   automated match to d3fm1a_
   complexed with ca, hem; mutant

Details for d5aboa1

PDB Entry: 5abo, 1.1 Å

PDB Description: crystal structure analysis of fungal versatile peroxidase from pleurotus eryngii. mutant vpi-br. mutated residues t2k, d69s, t70d, s86e, a131k, d146t, q202l, q219k, h232e, q239r, l288r, s301k, a308r, a309k and a314r.

PDB Compounds: (A:) versatile peroxidase vpl2

SCOPe Domain Sequences for d5aboa1:

Sequence; same for both SEQRES and ATOM records:

>d5aboa1 a.93.1.0 (A:3-315) automated matches {Pleurotus eryngii [TaxId: 5323]}
cddgrttanaaccilfpilddiqenlfdgaqcgeevheslrltfhdaigfsptlggggad
gsiiafsdietnfpanagideiveaqkpfvakhnisagdfiqfagavgvsncpggvripf
flgrpdavkaspdhlvpepfdsvtsilarmgdagfspvevvwllashsiaaadkvdpsip
gtpfdstpgvfdsqffietllkgrlfpgtadnkgeaksplqgeirlqsdellardprtac
ewqsmvnnqpkiqnrfaatmskmallgqdktklidcsdviptpparvgaahlpagfslkd
veqacrktpfprl

Timeline for d5aboa1:

• d5aboa1 first appeared in SCOPe 2.05, called d5aboa_
  
• d5aboa1 appears in SCOPe 2.07