SCOPe 2.05: Domain d4zn5a_: 4zn5 A:

Lineage for d4zn5a_ (4zn5 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein Protein-tyrosine phosphatase YopH, catalytic domain [100952] (2 species)

7. Species Yersinia enterocolitica [TaxId:630] [52812] (19 PDB entries)

8. Domain d4zn5a_: 4zn5 A: [278779]
   automated match to d1pa9a_
   complexed with act, dvg, gol, vo4

Details for d4zn5a_

PDB Entry: 4zn5, 1.12 Å

PDB Description: yoph w354y yersinia enterocolitica ptpase bond with divanadate glycerol ester in the active site

PDB Compounds: (A:) Tyrosine-protein phosphatase yopH

SCOPe Domain Sequences for d4zn5a_:

Sequence; same for both SEQRES and ATOM records:

>d4zn5a_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]}
spygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlna
nyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsg
tygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnypdqtavssevtk
alaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsq
lsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns

Timeline for d4zn5a_:

• d4zn5a_ is new in SCOPe 2.05-stable
  
• d4zn5a_ appears in SCOPe 2.06
  
• d4zn5a_ appears in the current release, SCOPe 2.08