Lineage for d4z6ba_ (4z6b A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1851756Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 1851757Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 1851855Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 1851860Protein Protein-tyrosine phosphatase YopH, catalytic domain [100952] (2 species)
  7. 1851865Species Yersinia enterocolitica [TaxId:630] [52812] (19 PDB entries)
  8. 1851870Domain d4z6ba_: 4z6b A: [278770]
    automated match to d1pa9a_
    complexed with act, gol

Details for d4z6ba_

PDB Entry: 4z6b (more details), 1.2 Å

PDB Description: yoph w354h yersinia enterocolitica ptpase in the apo form
PDB Compounds: (A:) Tyrosine-protein phosphatase yopH

SCOPe Domain Sequences for d4z6ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z6ba_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]}
spygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlna
nyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsg
tygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnhpdqtavssevtk
alaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsq
lsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns

SCOPe Domain Coordinates for d4z6ba_:

Click to download the PDB-style file with coordinates for d4z6ba_.
(The format of our PDB-style files is described here.)

Timeline for d4z6ba_: