Lineage for d4xwma_ (4xwm A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004283Family a.102.1.0: automated matches [191318] (1 protein)
    not a true family
  6. 2004284Protein automated matches [190108] (16 species)
    not a true protein
  7. 2004293Species Clostridium cellulovorans [TaxId:1493] [256855] (3 PDB entries)
  8. 2004294Domain d4xwma_: 4xwm A: [278767]
    automated match to d1l1ya_
    complexed with ca, cbi, cbk, edo

Details for d4xwma_

PDB Entry: 4xwm (more details), 1.7 Å

PDB Description: complex structure of catalytic domain of clostridium cellulovorans exgs and cellobiose
PDB Compounds: (A:) Exoglucanase S

SCOPe Domain Sequences for d4xwma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xwma_ a.102.1.0 (A:) automated matches {Clostridium cellulovorans [TaxId: 1493]}
vpnneyvqhfkdmyakihnanngyfsdegipyhavetlmveapdyghettseafsyymwl
eamnakltgdfsgfkkawdvtekyiipgetdqpsasmsnydpnkpatyaaehpdpsmyps
qlqfgaavgkdplynelkstygtsqvygmhwlldvdnwygfggatstspvyintfqrgvq
escwetvpqpckdemkyggrngfldlftgdsqyatqfkytnapdadaravqatyyaqlaa
kewgvdissyvakstkmgdflrysffdkyfrkvgnstqagtgydsaqyllnwyyawgggi
ssnwswrigsshnhfgyqnpmaawilsntsdfkpkspnaatdwnnslkrqiefyqwlqsa
eggiaggasnsnggsyqawpagtrtfygmgytphpvyedpgsnewfgmqawsmqrvaeyy
ysskdpaakslldkwakwacanvqfddaakkfkipaklvwtgqpdtwtgsytgnsnlhvk
veaygedlgvagslsnalsyyakalesstdaadkvayntaketsrkildylwasyqddkg
iavtetrndfkrfnqsvyipsgwtgkmpngdviqsgatflsirskykqdpswpnveaala
ngtgvdmtyhrfwgqsdiaiafgtygtlft

SCOPe Domain Coordinates for d4xwma_:

Click to download the PDB-style file with coordinates for d4xwma_.
(The format of our PDB-style files is described here.)

Timeline for d4xwma_: